PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00033615001
Common NameGSBRNA2T00033615001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 275aa    MW: 29621.5 Da    PI: 6.2287
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00033615001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like95.63.9e-30119172155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          +prl+Wtp+LH+rFv++v++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  GSBRNA2T00033615001 119 RPRLVWTPQLHKRFVDVVAHL-GIKNAVPKTIMQLMNVEGLTRENVASHLQKYRL 172
                          59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.252114175IPR017930Myb domain
SuperFamilySSF466891.24E-19116176IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.6E-30118177IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-23120172IPR006447Myb domain, plants
PfamPF002494.4E-8122171IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MGEEVRMSDY DVSGDGDRVL EWEMGLPSDD DLTSLSYSLI PPNLAMAFSI TPEKSRTIED  60
VNRASETTFS SLRSGSSGLN TSSSNNNSTS GDGVDLSTAT AAEEGDSGTE DPTGKTLKRP  120
RLVWTPQLHK RFVDVVAHLG IKNAVPKTIM QLMNVEGLTR ENVASHLQKY RLYLKRMQGL  180
TTEGPSSSDK LFSSTPVPPQ SFQEIGGGNG SGNGQGNVSA GYHHQSHGHD PYHQNRQHHH  240
GAGGFEANPY MMQQNKFGSM ASYPPVGGRS AHEN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A4e-21118177463ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013704864.11e-170PREDICTED: transcription factor LUX-like
RefseqXP_013704941.11e-170PREDICTED: transcription factor LUX-like
SwissprotQ9SNB41e-155PCL1_ARATH; Transcription factor LUX
TrEMBLA0A078JB420.0A0A078JB42_BRANA; BnaCnng37560D protein
STRINGBra018204.1-P1e-161(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40552758
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46640.21e-127G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]